HORDB

ID: hor006349
Uniprot ID: Q9Y5Q6
Protein name: Insulin-like peptide INSL5 A chain
Gene name: INSL5
Organism: Homo sapiens (Human)
Family: Insulin family
Source: Human
Expression: Highly expressed in rectum with lower levels in uterus and ascending and descending colon.
Disease: NA
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007165 signal transduction; GO:0008150 biological_process; GO:2000253 positive regulation of feeding behavior
GO CC: GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence: QDLQTLCCTDGCSMTDLSALC
Length: 21
Propeptide: MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
Signal peptide: MKGSIFTLFLFSVLFAISEVRS
Modification: T1 Pyrrolidone carboxylic acid
Glycosylation: NA
Mutagenesis: NA

Function: May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor.
Mechanism: NA
Cross BBB: NA
Target: RXFP4
Target Unid: Q8TDU9
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006349_AF2.pdb

hor006349_ESM.pdb

Mass:	257849	Formula:	C86H145N23O35S5
Absent amino acids:	EFHIKNPRVWY	Common amino acids:	CL
pI:	3.34	Basic residues:	0
Polar residues:	10	Hydrophobic residues:	5
Hydrophobicity:	34.76	Boman Index:	-2185
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	79.05
Instability Index:	4837.14	Extinction Coefficient cystines:	250
Absorbance 280nm:	12.5

PubMed ID: 10458910
Title: Identification of INSL5, a new member of the insulin superfamily.
PubMed ID: 12975309
Title: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
PubMed ID: 16710414
Title: The DNA sequence and biological annotation of human chromosome 1.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 15340161
Title: Signal peptide prediction based on analysis of experimentally verified cleavage sites.
PubMed ID: 15525639
Title: INSL5 is a high affinity specific agonist for GPCR142 (GPR100).
PubMed ID: 18576448
Title: Synthesis, conformation, and activity of human insulin-like peptide 5 (INSL5).
PubMed ID: 19178384
Title: Structure of human insulin-like peptide 5 and characterization of conserved hydrogen bonds and electrostatic interactions within the relaxin framework.